![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces sp. [TaxId:1001349] [258247] (2 PDB entries) |
![]() | Domain d4pxhe_: 4pxh E: [258781] Other proteins in same PDB: d4pxhb1, d4pxhb2, d4pxhd1, d4pxhd2, d4pxhf1, d4pxhf2 automated match to d1t87a_ complexed with hem, kh4 |
PDB Entry: 4pxh (more details), 2.7 Å
SCOPe Domain Sequences for d4pxhe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pxhe_ a.104.1.0 (E:) automated matches {Streptomyces sp. [TaxId: 1001349]} distinltdprtyevndlseywrqlrttrplywhppvgdapgfwvvsryadvmalykdnk kltsekgnvlvtllaggdsaagkmlavtdgamhrglrnvllksfspqalkpivdqirvnt trlvvdaarrgecdfaadvaeqiplntisdllgvpaadrefllklnksalssedadqsat dawlarneillyfselvaerrakptedvisvlansmvdgkplteevivlncyslilggde tsrlsmidsvqtftqypdqwellrdgkvtlesateevlrwatpamhfgrravtdmelhgq viaagdvvtlwnnsanrdeevfadpyafdlnrspnkhitfgygphfclgaylgraevhal ldalrtyttgfeitgepqrihsnfltglsrlpvriqpneaaiaayds
Timeline for d4pxhe_: