![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces sp. [TaxId:1001349] [258247] (2 PDB entries) |
![]() | Domain d4pwva_: 4pwv A: [258780] Other proteins in same PDB: d4pwvb1, d4pwvb2 automated match to d1t87a_ complexed with hem, kh4 |
PDB Entry: 4pwv (more details), 3 Å
SCOPe Domain Sequences for d4pwva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pwva_ a.104.1.0 (A:) automated matches {Streptomyces sp. [TaxId: 1001349]} pipddistinltdprtyevndlseywrqlrttrplywhppvgdapgfwvvsryadvmaly kdnkkltsekgnvlvtllaggdsaagkmlavtdgamhrglrnvllksfspqalkpivdqi rvnttrlvvdaarrgecdfaadvaeqiplntisdllgvpaadrefllklnksalssedad qsatdawlarneillyfselvaerrakptedvisvlansmvdgkplteevivlncyslil ggdetsrlsmidsvqtftqypdqwellrdgkvtlesateevlrwatpamhfgrravtdme lhgqviaagdvvtlwnnsanrdeevfadpyafdlnrspnkhitfgygphfclgaylgrae vhalldalrtyttgfeitgepqrihsnfltglsrlpvriqpneaaiaayds
Timeline for d4pwva_: