Lineage for d4pwva_ (4pwv A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005914Species Streptomyces sp. [TaxId:1001349] [258247] (2 PDB entries)
  8. 2005918Domain d4pwva_: 4pwv A: [258780]
    Other proteins in same PDB: d4pwvb_
    automated match to d1t87a_
    complexed with hem, kh4

Details for d4pwva_

PDB Entry: 4pwv (more details), 3 Å

PDB Description: Structure of P450sky (CYP163B3), a cytochrome P450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain
PDB Compounds: (A:) P450 monooxygenase

SCOPe Domain Sequences for d4pwva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pwva_ a.104.1.0 (A:) automated matches {Streptomyces sp. [TaxId: 1001349]}
pipddistinltdprtyevndlseywrqlrttrplywhppvgdapgfwvvsryadvmaly
kdnkkltsekgnvlvtllaggdsaagkmlavtdgamhrglrnvllksfspqalkpivdqi
rvnttrlvvdaarrgecdfaadvaeqiplntisdllgvpaadrefllklnksalssedad
qsatdawlarneillyfselvaerrakptedvisvlansmvdgkplteevivlncyslil
ggdetsrlsmidsvqtftqypdqwellrdgkvtlesateevlrwatpamhfgrravtdme
lhgqviaagdvvtlwnnsanrdeevfadpyafdlnrspnkhitfgygphfclgaylgrae
vhalldalrtyttgfeitgepqrihsnfltglsrlpvriqpneaaiaayds

SCOPe Domain Coordinates for d4pwva_:

Click to download the PDB-style file with coordinates for d4pwva_.
(The format of our PDB-style files is described here.)

Timeline for d4pwva_: