| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
| Protein automated matches [191038] (29 species) not a true protein |
| Species Streptomyces sp. [TaxId:1001349] [258245] (2 PDB entries) |
| Domain d4pxhb1: 4pxh B:6-78 [258778] Other proteins in same PDB: d4pxha_, d4pxhb2, d4pxhc_, d4pxhd2, d4pxhe_, d4pxhf2 automated match to d1dnya_ complexed with hem, kh4 |
PDB Entry: 4pxh (more details), 2.7 Å
SCOPe Domain Sequences for d4pxhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pxhb1 a.28.1.0 (B:6-78) automated matches {Streptomyces sp. [TaxId: 1001349]}
reprnetesrlrrifeevlhsedvdveanffelgghslqatklvsrirsefdaelplrdf
fehpnvaglavli
Timeline for d4pxhb1: