SCOPe 2.08: Domain d4pxhd1: 4pxh D:6-78

Lineage for d4pxhd1 (4pxh D:6-78)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (29 species)
   not a true protein

7. Species Streptomyces sp. [TaxId:1001349] [258245] (2 PDB entries)

8. Domain d4pxhd1: 4pxh D:6-78 [258777]
   Other proteins in same PDB: d4pxha_, d4pxhb2, d4pxhc_, d4pxhd2, d4pxhe_, d4pxhf2
   automated match to d1dnya_
   complexed with hem, kh4

Details for d4pxhd1

PDB Entry: 4pxh, 2.7 Å

PDB Description: Structure of P450sky (CYP163B3), a cytochrome P450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain

PDB Compounds: (D:) Peptide synthetase

SCOPe Domain Sequences for d4pxhd1:

Sequence; same for both SEQRES and ATOM records:

>d4pxhd1 a.28.1.0 (D:6-78) automated matches {Streptomyces sp. [TaxId: 1001349]}
reprnetesrlrrifeevlhsedvdveanffelgghslqatklvsrirsefdaelplrdf
fehpnvaglavli

Timeline for d4pxhd1:

• d4pxhd1 first appeared in SCOPe 2.04, called d4pxhd_
  
• d4pxhd1 appears in SCOPe 2.07