![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4pj7g2: 4pj7 G:111-199 [258775] Other proteins in same PDB: d4pj7a1, d4pj7a2, d4pj7a3, d4pj7b_, d4pj7c1, d4pj7c2, d4pj7c3, d4pj7d_, d4pj7e1, d4pj7f1, d4pj7f2, d4pj7g1, d4pj7h1, d4pj7h2 automated match to d2f54d2 complexed with 2lj |
PDB Entry: 4pj7 (more details), 2.5 Å
SCOPe Domain Sequences for d4pj7g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj7g2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
Timeline for d4pj7g2: