SCOPe 2.04: Domain d4pj5h1: 4pj5 H:3-116

Lineage for d4pj5h1 (4pj5 H:3-116)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4pj5h1: 4pj5 H:3-116 [258770]
   Other proteins in same PDB: d4pj5d2
   automated match to d2axhb1
   complexed with 30w

Details for d4pj5h1

PDB Entry: 4pj5, 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait trbv6-1 tcr

PDB Compounds: (H:) TCR-beta

SCOPe Domain Sequences for d4pj5h1:

Sequence; same for both SEQRES and ATOM records:

>d4pj5h1 b.1.1.0 (H:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

Timeline for d4pj5h1:

• d4pj5h1 is new in SCOPe 2.04-stable
  
• d4pj5h1 appears in SCOPe 2.05
  
• d4pj5h1 appears in the current release, SCOPe 2.08