Lineage for d2tpiz_ (2tpi Z:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065448Protein Trypsin(ogen) [50515] (9 species)
  7. 2065466Species Cow (Bos taurus) [TaxId:9913] [50516] (418 PDB entries)
    Uniprot P00760
  8. 2065857Domain d2tpiz_: 2tpi Z: [25877]
    Other proteins in same PDB: d2tpii_
    complexed with hg, ile, val

Details for d2tpiz_

PDB Entry: 2tpi (more details), 2.1 Å

PDB Description: on the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
PDB Compounds: (Z:) trypsinogen

SCOPe Domain Sequences for d2tpiz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tpiz_ b.47.1.2 (Z:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
gytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvvegneq
fisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgwgn
tkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpvvc
sgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d2tpiz_:

Click to download the PDB-style file with coordinates for d2tpiz_.
(The format of our PDB-style files is described here.)

Timeline for d2tpiz_: