![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4pj5d2: 4pj5 D:111-200 [258763] Other proteins in same PDB: d4pj5a1, d4pj5a2, d4pj5b1, d4pj5b2, d4pj5c1, d4pj5c2, d4pj5d1, d4pj5e1, d4pj5e2, d4pj5f_, d4pj5g1, d4pj5h1, d4pj5h2 automated match to d2f54d2 complexed with 30w |
PDB Entry: 4pj5 (more details), 2 Å
SCOPe Domain Sequences for d4pj5d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj5d2 b.1.1.2 (D:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffpsp
Timeline for d4pj5d2: