![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4pjbf2: 4pjb F:117-238 [258760] Other proteins in same PDB: d4pjba1, d4pjba2, d4pjba3, d4pjbb_, d4pjbc1, d4pjbc2, d4pjbc3, d4pjbd_, d4pjbe1, d4pjbf1, d4pjbg1, d4pjbh1 automated match to d3of6b2 complexed with 2lj, gol |
PDB Entry: 4pjb (more details), 2.85 Å
SCOPe Domain Sequences for d4pjbf2:
Sequence, based on SEQRES records: (download)
>d4pjbf2 b.1.1.2 (F:117-238) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs ae
>d4pjbf2 b.1.1.2 (F:117-238) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqrcqvqfyglsendewtqdrakpvtqivsae
Timeline for d4pjbf2: