Lineage for d4pjbg2 (4pjb G:111-198)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763426Domain d4pjbg2: 4pjb G:111-198 [258757]
    Other proteins in same PDB: d4pjba1, d4pjba2, d4pjbb_, d4pjbc1, d4pjbc2, d4pjbd_, d4pjbe1, d4pjbf1, d4pjbg1, d4pjbh1
    automated match to d2f54d2
    complexed with 2lj, gol

Details for d4pjbg2

PDB Entry: 4pjb (more details), 2.85 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait b-f3-c1 tcr
PDB Compounds: (G:) TCR-alpha

SCOPe Domain Sequences for d4pjbg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjbg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

SCOPe Domain Coordinates for d4pjbg2:

Click to download the PDB-style file with coordinates for d4pjbg2.
(The format of our PDB-style files is described here.)

Timeline for d4pjbg2: