SCOP 1.75: Domain d1tgba_: 1tgb A:

Lineage for d1tgba_ (1tgb A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (279 PDB entries)
   Uniprot P00760

8. Domain d1tgba_: 1tgb A: [25875]
   complexed with ca

Details for d1tgba_

PDB Entry: 1tgb, 1.8 Å

PDB Description: crystal structure of bovine trypsinogen at 1.8 angstroms resolution. ii. crystallographic refinement, refined crystal structure and comparison with bovine trypsin

PDB Compounds: (A:) trypsinogen

SCOP Domain Sequences for d1tgba_:

Sequence; same for both SEQRES and ATOM records:

>d1tgba_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1tgba_:

• d1tgba_ first appeared (with stable ids) in SCOP 1.55, called d1tgb__
  
• d1tgba_ appears in SCOP 1.73
  
• d1tgba_ appears in SCOPe 2.01
  
• d1tgba_ appears in the current release, SCOPe 2.08