Lineage for d4pjif1 (4pji F:3-115)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033303Domain d4pjif1: 4pji F:3-115 [258748]
    Other proteins in same PDB: d4pjia1, d4pjib1, d4pjib2, d4pjic1, d4pjid1, d4pjid2, d4pjie2, d4pjif2, d4pjig2, d4pjih2
    automated match to d3of6c1
    complexed with 30w, gol, na

Details for d4pjif1

PDB Entry: 4pji (more details), 2.5 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-c10 tcr
PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pjif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjif1 b.1.1.0 (F:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcassppggtdtqyfgegsrltvled

SCOPe Domain Coordinates for d4pjif1:

Click to download the PDB-style file with coordinates for d4pjif1.
(The format of our PDB-style files is described here.)

Timeline for d4pjif1: