SCOPe 2.07: Domain d4pjaf2: 4pja F:116-237

Lineage for d4pjaf2 (4pja F:116-237)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4pjaf2: 4pja F:116-237 [258747]
   Other proteins in same PDB: d4pjaa1, d4pjaa2, d4pjaa3, d4pjab_, d4pjac1, d4pjac2, d4pjac3, d4pjad_, d4pjae1, d4pjaf1, d4pjag1, d4pjah1
   automated match to d3of6b2
   complexed with 2lj, gol

Details for d4pjaf2

PDB Entry: 4pja, 2.68 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait b-b10 tcr

PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pjaf2:

Sequence; same for both SEQRES and ATOM records:

>d4pjaf2 b.1.1.2 (F:116-237) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
ae

Timeline for d4pjaf2:

• d4pjaf2 first appeared in SCOPe 2.04
  
• d4pjaf2 appears in SCOPe 2.06
  
• d4pjaf2 appears in the current release, SCOPe 2.08