| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (29 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
| Domain d4pjaf1: 4pja F:3-115 [258746] Other proteins in same PDB: d4pjaa1, d4pjaa3, d4pjab_, d4pjac1, d4pjac3, d4pjad_, d4pjae2, d4pjaf2, d4pjag2, d4pjah2 automated match to d3of6c1 complexed with 2lj, gol |
PDB Entry: 4pja (more details), 2.68 Å
SCOPe Domain Sequences for d4pjaf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjaf1 b.1.1.0 (F:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcastlgqegqpqhfgegsrltvled
Timeline for d4pjaf1: