Lineage for d4pjcc2 (4pjc C:179-269)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033130Domain d4pjcc2: 4pjc C:179-269 [258745]
    Other proteins in same PDB: d4pjca1, d4pjca3, d4pjcb_, d4pjcc1, d4pjcc3, d4pjcd_, d4pjce2, d4pjcf2, d4pjcg2, d4pjch2
    automated match to d4l4ta2
    complexed with 2lj, b3p

Details for d4pjcc2

PDB Entry: 4pjc (more details), 2.5 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait c-a11 tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjcc2:

Sequence, based on SEQRES records: (download)

>d4pjcc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records): (download)

>d4pjcc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrktalfckahgfyppeiymtwmkngeeieidygdilpsgdgtyqawasiel
lyschvehsgvhmvlqv

SCOPe Domain Coordinates for d4pjcc2:

Click to download the PDB-style file with coordinates for d4pjcc2.
(The format of our PDB-style files is described here.)

Timeline for d4pjcc2: