| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4pjcc2: 4pjc C:179-269 [258745] Other proteins in same PDB: d4pjca1, d4pjca3, d4pjcb_, d4pjcc1, d4pjcc3, d4pjcd_, d4pjce2, d4pjcf2, d4pjcg2, d4pjch2 automated match to d4l4ta2 complexed with 2lj, b3p |
PDB Entry: 4pjc (more details), 2.5 Å
SCOPe Domain Sequences for d4pjcc2:
Sequence, based on SEQRES records: (download)
>d4pjcc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv
>d4pjcc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrktalfckahgfyppeiymtwmkngeeieidygdilpsgdgtyqawasiel
lyschvehsgvhmvlqv
Timeline for d4pjcc2: