SCOPe 2.05: Domain d1aq7a_: 1aq7 A:

Lineage for d1aq7a_ (1aq7 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (396 PDB entries)
   Uniprot P00760

8. Domain d1aq7a_: 1aq7 A: [25874]

Details for d1aq7a_

PDB Entry: 1aq7, 2.2 Å

PDB Description: trypsin with inhibitor aeruginosin 98-b

PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1aq7a_:

Sequence; same for both SEQRES and ATOM records:

>d1aq7a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1aq7a_:

• d1aq7a_ first appeared (with stable ids) in SCOP 1.55, called d1aq7__
  
• d1aq7a_ appears in SCOPe 2.04
  
• d1aq7a_ appears in SCOPe 2.06
  
• d1aq7a_ appears in the current release, SCOPe 2.08