Lineage for d1aq7__ (1aq7 -)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 465819Protein Trypsin(ogen) [50515] (8 species)
  7. 465820Species Cow (Bos taurus) [TaxId:9913] [50516] (229 PDB entries)
  8. 466031Domain d1aq7__: 1aq7 - [25874]

Details for d1aq7__

PDB Entry: 1aq7 (more details), 2.2 Å

PDB Description: trypsin with inhibitor aeruginosin 98-b

SCOP Domain Sequences for d1aq7__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aq7__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1aq7__:

Click to download the PDB-style file with coordinates for d1aq7__.
(The format of our PDB-style files is described here.)

Timeline for d1aq7__: