SCOP 1.59: Domain d1aq7__: 1aq7 -

Lineage for d1aq7__ (1aq7 -)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)

6. Protein Trypsin(ogen) [50515] (7 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (147 PDB entries)

8. Domain d1aq7__: 1aq7 - [25874]

Details for d1aq7__

PDB Entry: 1aq7, 2.2 Å

PDB Description: trypsin with inhibitor aeruginosin 98-b

SCOP Domain Sequences for d1aq7__:

Sequence; same for both SEQRES and ATOM records:

>d1aq7__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1aq7__:

• d1aq7__ first appeared (with stable ids) in SCOP 1.55
  
• d1aq7__ appears in SCOP 1.57
  
• d1aq7__ appears in SCOP 1.61
  
• d1aq7__ appears in the current release, SCOPe 2.08, called d1aq7a_