Lineage for d1aq7__ (1aq7 -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60859Protein Trypsin(ogen) [50515] (6 species)
  7. 60860Species Cow (Bos taurus) [TaxId:9913] [50516] (128 PDB entries)
  8. 60976Domain d1aq7__: 1aq7 - [25874]

Details for d1aq7__

PDB Entry: 1aq7 (more details), 2.2 Å

PDB Description: trypsin with inhibitor aeruginosin 98-b

SCOP Domain Sequences for d1aq7__:

Sequence, based on SEQRES records: (download)

>d1aq7__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Sequence, based on observed residues (ATOM records): (download)

>d1aq7__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1aq7__:

Click to download the PDB-style file with coordinates for d1aq7__.
(The format of our PDB-style files is described here.)

Timeline for d1aq7__: