SCOPe 2.08: Domain d4pjic2: 4pji C:179-269

Lineage for d4pjic2 (4pji C:179-269)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4pjic2: 4pji C:179-269 [258736]
   Other proteins in same PDB: d4pjia1, d4pjib1, d4pjib2, d4pjic1, d4pjid1, d4pjid2, d4pjie2, d4pjif2, d4pjig2, d4pjih2
   automated match to d4l4ta2
   complexed with 30w, gol, na

Details for d4pjic2

PDB Entry: 4pji, 2.5 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-c10 tcr

PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjic2:

Sequence, based on SEQRES records:

>d4pjic2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records):

>d4pjic2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnalfckahgfyppeiymtwmkngeeeidygdilpsgdgtyqawasiellysc
hvehsgvhmvlqv

Timeline for d4pjic2:

• d4pjic2 first appeared in SCOPe 2.04
  
• d4pjic2 appears in SCOPe 2.07