![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d4pjic2: 4pji C:179-269 [258736] Other proteins in same PDB: d4pjia1, d4pjib1, d4pjib2, d4pjic1, d4pjid1, d4pjid2, d4pjie2, d4pjif2, d4pjig2, d4pjih2 automated match to d4l4ta2 complexed with 30w, gol, na |
PDB Entry: 4pji (more details), 2.5 Å
SCOPe Domain Sequences for d4pjic2:
Sequence, based on SEQRES records: (download)
>d4pjic2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty qawasieldpqssnlyschvehsgvhmvlqv
>d4pjic2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnalfckahgfyppeiymtwmkngeeeidygdilpsgdgtyqawasiellysc hvehsgvhmvlqv
Timeline for d4pjic2: