| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
| Protein automated matches [226842] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
| Domain d4pjac1: 4pja C:1-178 [258735] Other proteins in same PDB: d4pjaa2, d4pjaa3, d4pjab_, d4pjac2, d4pjac3, d4pjad_, d4pjae1, d4pjae2, d4pjaf1, d4pjaf2, d4pjag1, d4pjag2, d4pjah1, d4pjah2 automated match to d4l4ta1 complexed with 2lj, gol |
PDB Entry: 4pja (more details), 2.68 Å
SCOPe Domain Sequences for d4pjac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjac1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d4pjac1: