Lineage for d4pjac1 (4pja C:1-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938811Domain d4pjac1: 4pja C:1-178 [258735]
    Other proteins in same PDB: d4pjaa2, d4pjaa3, d4pjab_, d4pjac2, d4pjac3, d4pjad_, d4pjae1, d4pjae2, d4pjaf1, d4pjaf2, d4pjag1, d4pjag2, d4pjah1, d4pjah2
    automated match to d4l4ta1
    complexed with 2lj, gol

Details for d4pjac1

PDB Entry: 4pja (more details), 2.68 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait b-b10 tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjac1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4pjac1:

Click to download the PDB-style file with coordinates for d4pjac1.
(The format of our PDB-style files is described here.)

Timeline for d4pjac1: