Lineage for d4pjia2 (4pji A:179-269)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520008Domain d4pjia2: 4pji A:179-269 [258734]
    Other proteins in same PDB: d4pjia1, d4pjic1, d4pjif2, d4pjig2
    automated match to d4l4ta2
    complexed with 30w, gol, na

Details for d4pjia2

PDB Entry: 4pji (more details), 2.5 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-c10 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjia2:

Sequence, based on SEQRES records: (download)

>d4pjia2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records): (download)

>d4pjia2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasiellyschvehsgvhmvlqv

SCOPe Domain Coordinates for d4pjia2:

Click to download the PDB-style file with coordinates for d4pjia2.
(The format of our PDB-style files is described here.)

Timeline for d4pjia2: