SCOPe 2.04: Domain d4pjia2: 4pji A:179-269

Lineage for d4pjia2 (4pji A:179-269)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4pjia2: 4pji A:179-269 [258734]
   Other proteins in same PDB: d4pjia1, d4pjic1, d4pjif2, d4pjig2
   automated match to d4l4ta2
   complexed with 30w, gol, na

Details for d4pjia2

PDB Entry: 4pji, 2.5 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-c10 tcr

PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjia2:

Sequence, based on SEQRES records:

>d4pjia2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records):

>d4pjia2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasiellyschvehsgvhmvlqv

Timeline for d4pjia2:

• d4pjia2 is new in SCOPe 2.04-stable
  
• d4pjia2 appears in SCOPe 2.05
  
• d4pjia2 appears in the current release, SCOPe 2.08