Lineage for d4pjia1 (4pji A:1-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938792Domain d4pjia1: 4pji A:1-178 [258732]
    Other proteins in same PDB: d4pjia2, d4pjib1, d4pjib2, d4pjic2, d4pjid1, d4pjid2, d4pjie1, d4pjie2, d4pjif1, d4pjif2, d4pjig1, d4pjig2, d4pjih1, d4pjih2
    automated match to d4l4ta1
    complexed with 30w, gol, na

Details for d4pjia1

PDB Entry: 4pji (more details), 2.5 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-c10 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjia1:

Sequence, based on SEQRES records: (download)

>d4pjia1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Sequence, based on observed residues (ATOM records): (download)

>d4pjia1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpigvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwer
ytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfli
fnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4pjia1:

Click to download the PDB-style file with coordinates for d4pjia1.
(The format of our PDB-style files is described here.)

Timeline for d4pjia1: