SCOPe 2.04: Domain d4pfqg_: 4pfq G:

Lineage for d4pfqg_ (4pfq G:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (23 species)
   not a true protein

7. Species Brachybacterium faecium [TaxId:446465] [258122] (1 PDB entry)

8. Domain d4pfqg_: 4pfq G: [258728]
   automated match to d3h83a_
   complexed with mg

Details for d4pfqg_

PDB Entry: 4pfq, 2.1 Å

PDB Description: crystal structure of hypoxanthine phosphoribosyltransferase from brachybacterium faecium dsm 4810, nysgrc target 029763.

PDB Compounds: (G:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4pfqg_:

Sequence; same for both SEQRES and ATOM records:

>d4pfqg_ c.61.1.0 (G:) automated matches {Brachybacterium faecium [TaxId: 446465]}
phpdvdrvlldeqqirdrlaelgeqiaadyaeeppvlvgvlrgavmvmadlarqidlkve
mdwmavssygsgtkssgvvrilkdlsgditdrnvlivediidsgltlkwllsnlrsrgpk
svevaallrkpdaarvdidvkyigfdipsefvigygldyaenyrnlpyvgvlsrsvy

Timeline for d4pfqg_:

• d4pfqg_ is new in SCOPe 2.04-stable
  
• d4pfqg_ appears in SCOPe 2.05
  
• d4pfqg_ appears in the current release, SCOPe 2.08