SCOPe 2.06: Domain d2tgpz_: 2tgp Z:

Lineage for d2tgpz_ (2tgp Z:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (418 PDB entries)
   Uniprot P00760

8. Domain d2tgpz_: 2tgp Z: [25872]
   Other proteins in same PDB: d2tgpi_
   complexed with ca, so4

Details for d2tgpz_

PDB Entry: 2tgp, 1.9 Å

PDB Description: the geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors

PDB Compounds: (Z:) trypsinogen

SCOPe Domain Sequences for d2tgpz_:

Sequence; same for both SEQRES and ATOM records:

>d2tgpz_ b.47.1.2 (Z:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2tgpz_:

• d2tgpz_ first appeared (with stable ids) in SCOP 1.55
  
• d2tgpz_ appears in SCOPe 2.05
  
• d2tgpz_ appears in SCOPe 2.07
  
• d2tgpz_ appears in the current release, SCOPe 2.08