Lineage for d4p6tb_ (4p6t B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719416Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2719417Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2719484Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 2719485Protein automated matches [254708] (4 species)
    not a true protein
  7. 2719486Species Bacillus megaterium [TaxId:1404] [255981] (21 PDB entries)
  8. 2719524Domain d4p6tb_: 4p6t B: [258719]
    automated match to d4j6vb_
    complexed with cu, yrl

Details for d4p6tb_

PDB Entry: 4p6t (more details), 2.5 Å

PDB Description: crystal structure of tyrosinase from bacillus megaterium with p- tyrosol in the active site
PDB Compounds: (B:) tyrosinase

SCOPe Domain Sequences for d4p6tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p6tb_ a.86.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydie

SCOPe Domain Coordinates for d4p6tb_:

Click to download the PDB-style file with coordinates for d4p6tb_.
(The format of our PDB-style files is described here.)

Timeline for d4p6tb_: