SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4p6sb_ (4p6s B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002034Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2002035Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2002102Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 2002103Protein automated matches [254708] (2 species)
    not a true protein
  7. 2002104Species Bacillus megaterium [TaxId:1404] [255981] (18 PDB entries)
  8. 2002118Domain d4p6sb_: 4p6s B: [258716]
    automated match to d4j6vb_
    complexed with dah, zn

Details for d4p6sb_

PDB Entry: 4p6s (more details), 2.2 Å

PDB Description: Crystal Structure of tyrosinase from Bacillus megaterium with L-DOPA in the active site
PDB Compounds: (B:) tyrosinase

SCOPe Domain Sequences for d4p6sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p6sb_ a.86.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel

SCOPe Domain Coordinates for d4p6sb_:

Click to download the PDB-style file with coordinates for d4p6sb_.
(The format of our PDB-style files is described here.)

Timeline for d4p6sb_: