Class b: All beta proteins [48724] (177 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187833] (30 PDB entries) |
Domain d4orub_: 4oru B: [258706] automated match to d2k23a_ complexed with peu; mutant |
PDB Entry: 4oru (more details), 1.55 Å
SCOPe Domain Sequences for d4orub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4orub_ b.60.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} svqpnfqqdkflgrwfsaglasnsswlrekkaalsmaksvvapatdgglnltstflrknq cetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrmatl ysrtqtpraelkekftafckaqgftedtivflpqtdkcm
Timeline for d4orub_: