SCOPe 2.04: Domain d4orwb_: 4orw B:

Lineage for d4orwb_ (4orw B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187833] (24 PDB entries)

8. Domain d4orwb_: 4orw B: [258702]
   automated match to d2k23a_
   mutant

Details for d4orwb_

PDB Entry: 4orw, 1.66 Å

PDB Description: Three-dimensional structure of the C65A-K59A double mutant of Human lipocalin-type Prostaglandin D Synthase apo-form

PDB Compounds: (B:) Prostaglandin-H2 D-isomerase

SCOPe Domain Sequences for d4orwb_:

Sequence; same for both SEQRES and ATOM records:

>d4orwb_ b.60.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svqpnfqqdkflgrwfsaglasnsswlrekaaalsmaksvvapatdgglnltstflrknq
cetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrmatl
ysrtqtpraelkekftafckaqgftedtivflpqtdkcm

Timeline for d4orwb_:

• d4orwb_ is new in SCOPe 2.04-stable
  
• d4orwb_ appears in SCOPe 2.05
  
• d4orwb_ appears in the current release, SCOPe 2.08