SCOPe 2.05: Domain d4ooua_: 4oou A:

Lineage for d4ooua_ (4oou A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Cryptopygus antarcticus [TaxId:187623] [258696] (2 PDB entries)

8. Domain d4ooua_: 4oou A: [258699]
   automated match to d2c0ha1
   complexed with trs

Details for d4ooua_

PDB Entry: 4oou, 2.36 Å

PDB Description: crystal structure of beta-1,4-d-mannanase from cryptopygus antarcticus

PDB Compounds: (A:) beta-1,4-mannanase

SCOPe Domain Sequences for d4ooua_:

Sequence; same for both SEQRES and ATOM records:

>d4ooua_ c.1.8.0 (A:) automated matches {Cryptopygus antarcticus [TaxId: 187623]}
seflkasgsnfyyggqkvflsgvnfawrsygsdfgngqyasngpalkdwinkvkasggnt
arvwvhvegqvspafdshgfvtstdskktlindlsdlldyangqnvflilvlfngalqnn
snvqnlfwdesklnsyinnaltpmvnalkskpslaawevlnepegtlqpgsdqnscydts
tlaaqgagwggkkfpmkqilktinwissaihnadskalvtvgswseltqtdsfgyrnhyk
dscltgaggksngiinfyqmhtyshsgkwnqnapfkvnrwaynvndkplligefasvcsq
negiqnlykyaynngyngaltwqfnsggdcsdtysnqmygmqalkgqndqsggkggmvsv
ninh

Timeline for d4ooua_:

• d4ooua_ first appeared in SCOPe 2.04
  
• d4ooua_ is called d4ooua1 in SCOPe 2.06
  
• d4ooua_ appears in the current release, SCOPe 2.08, called d4ooua1