Lineage for d4lqfl2 (4lqf L:114-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364194Domain d4lqfl2: 4lqf L:114-219 [258680]
    Other proteins in same PDB: d4lqfl1
    automated match to d1t66c2
    complexed with zn

Details for d4lqfl2

PDB Entry: 4lqf (more details), 2.3 Å

PDB Description: structure of murine igg2b a2c7-fab in complex with vaccinia antigen a33r at the resolution of 2.3 angstroms
PDB Compounds: (L:) Murine IgG2b A2C7 Light chain Fab domain

SCOPe Domain Sequences for d4lqfl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lqfl2 b.1.1.2 (L:114-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifptiseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4lqfl2:

Click to download the PDB-style file with coordinates for d4lqfl2.
(The format of our PDB-style files is described here.)

Timeline for d4lqfl2: