SCOP 1.57: Domain d2ptce_: 2ptc E:

Lineage for d2ptce_ (2ptc E:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)

6. Protein Trypsin(ogen) [50515] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (128 PDB entries)

8. Domain d2ptce_: 2ptc E: [25867]
   Other proteins in same PDB: d2ptci_

Details for d2ptce_

PDB Entry: 2ptc, 1.9 Å

PDB Description: the geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors

SCOP Domain Sequences for d2ptce_:

Sequence; same for both SEQRES and ATOM records:

>d2ptce_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2ptce_:

• d2ptce_ first appeared (with stable ids) in SCOP 1.55
  
• d2ptce_ appears in SCOP 1.59
  
• d2ptce_ appears in the current release, SCOPe 2.08