Lineage for d2ptce_ (2ptc E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries) 
Domain d2ptce_: 2ptc E: [25867]
Other proteins in same PDB: d2ptci_
Details for d2ptce_
PDB Entry: 2ptc (more details), 1.9 Å
PDB Description: the geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
SCOP Domain Sequences for d2ptce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ptce_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d2ptce_:
Click to download the PDB-style file with coordinates for d2ptce_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ptce_:
- d2ptce_ appears in SCOP 1.57
- d2ptce_ appears in the current release, SCOPe 2.08
View in 3D
