Lineage for d4ijud_ (4iju D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1576689Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1576716Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 1576732Species Human (Homo sapiens) [TaxId:9606] [117424] (26 PDB entries)
    Uniprot P28845
  8. 1576789Domain d4ijud_: 4iju D: [258662]
    automated match to d3tfqb_
    complexed with 1eo, cl, nap; mutant

Details for d4ijud_

PDB Entry: 4iju (more details), 2.35 Å

PDB Description: Crystal structure of 11b-HSD1 double mutant (L262R, F278E) in complex with (1S,4S)-4-[8-(2-fluorophenoxy)[1,2,4]triazolo[4,3-a]pyridin-3-yl]bicyclo[2.2.1]heptan-1-ol
PDB Compounds: (D:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d4ijud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ijud_ c.2.1.2 (D:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
masmtggqqmgrgsneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarske
tlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlf
hddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfa
ldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikgg
alrqeevyydssrwttllirnpcrkileelystsy

SCOPe Domain Coordinates for d4ijud_:

Click to download the PDB-style file with coordinates for d4ijud_.
(The format of our PDB-style files is described here.)

Timeline for d4ijud_:

  • d4ijud_ appears in periodic updates to SCOPe 2.04 starting on 2014-08-06
  • d4ijud_ appears in SCOPe 2.05
  • d4ijud_ appears in the current release, SCOPe 2.07, called d4ijud1