Lineage for d1tgna_ (1tgn A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056829Protein Trypsin(ogen) [50515] (9 species)
  7. 2056847Species Cow (Bos taurus) [TaxId:9913] [50516] (418 PDB entries)
    Uniprot P00760
  8. 2057179Domain d1tgna_: 1tgn A: [25866]

Details for d1tgna_

PDB Entry: 1tgn (more details), 1.65 Å

PDB Description: structure of bovine trypsinogen at 1.9 angstroms resolution
PDB Compounds: (A:) trypsinogen

SCOPe Domain Sequences for d1tgna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgna_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
vggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvvegn
eqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgw
gntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpv
vcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d1tgna_:

Click to download the PDB-style file with coordinates for d1tgna_.
(The format of our PDB-style files is described here.)

Timeline for d1tgna_: