Lineage for d4cisb3 (4cis B:219-271)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262786Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 2262787Protein automated matches [190463] (7 species)
    not a true protein
  7. 2262848Species Lactococcus lactis [TaxId:1359] [256615] (1 PDB entry)
  8. 2262850Domain d4cisb3: 4cis B:219-271 [258653]
    Other proteins in same PDB: d4cisa1, d4cisa2, d4cisb1, d4cisb2
    automated match to d1xc8a3
    protein/DNA complex; complexed with bu3, zn

Details for d4cisb3

PDB Entry: 4cis (more details), 2.05 Å

PDB Description: structure of mutm in complex with carbocyclic 8-oxo-g containing dna
PDB Compounds: (B:) formamidopyrimidin DNA glycosylase

SCOPe Domain Sequences for d4cisb3:

Sequence, based on SEQRES records: (download)

>d4cisb3 g.39.1.0 (B:219-271) automated matches {Lactococcus lactis [TaxId: 1359]}
irtysalgstgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpfcqqk

Sequence, based on observed residues (ATOM records): (download)

>d4cisb3 g.39.1.0 (B:219-271) automated matches {Lactococcus lactis [TaxId: 1359]}
irlgstgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpfcqqk

SCOPe Domain Coordinates for d4cisb3:

Click to download the PDB-style file with coordinates for d4cisb3.
(The format of our PDB-style files is described here.)

Timeline for d4cisb3: