SCOPe 2.05: Domain d4cphb_: 4cph B:

Lineage for d4cphb_ (4cph B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (34 PDB entries)

8. Domain d4cphb_: 4cph B: [258652]
   automated match to d1n9mc_
   complexed with lh4

Details for d4cphb_

PDB Entry: 4cph, 1.64 Å

PDB Description: trans-divalent streptavidin with love-hate ligand 4

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d4cphb_:

Sequence; same for both SEQRES and ATOM records:

>d4cphb_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

Timeline for d4cphb_:

• d4cphb_ first appeared in SCOPe 2.04
  
• d4cphb_ appears in SCOPe 2.06
  
• d4cphb_ appears in the current release, SCOPe 2.08