Lineage for d4cphc_ (4cph C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806221Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)
  8. 2806362Domain d4cphc_: 4cph C: [258651]
    automated match to d1n9mc_
    complexed with lh4

Details for d4cphc_

PDB Entry: 4cph (more details), 1.64 Å

PDB Description: trans-divalent streptavidin with love-hate ligand 4
PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d4cphc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cphc_ b.61.1.1 (C:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

SCOPe Domain Coordinates for d4cphc_:

Click to download the PDB-style file with coordinates for d4cphc_.
(The format of our PDB-style files is described here.)

Timeline for d4cphc_: