Lineage for d1ppee_ (1ppe E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60859Protein Trypsin(ogen) [50515] (6 species)
  7. 60860Species Cow (Bos taurus) [TaxId:9913] [50516] (128 PDB entries)
  8. 60955Domain d1ppee_: 1ppe E: [25865]
    Other proteins in same PDB: d1ppei_

Details for d1ppee_

PDB Entry: 1ppe (more details), 2 Å

PDB Description: the refined 2.0 angstroms x-ray crystal structure of the complex formed between bovine beta-trypsin and cmti-i, a trypsin inhibitor from squash seeds (cucurbita maxima): topological similarity of the squash seed inhibitors with the carboxypeptidase a inhibitor from potatoes

SCOP Domain Sequences for d1ppee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppee_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1ppee_:

Click to download the PDB-style file with coordinates for d1ppee_.
(The format of our PDB-style files is described here.)

Timeline for d1ppee_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ppei_