SCOP 1.55: Domain d1ppee_: 1ppe E:

Lineage for d1ppee_ (1ppe E:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)

6. Protein Trypsin(ogen) [50515] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries)

8. Domain d1ppee_: 1ppe E: [25865]
   Other proteins in same PDB: d1ppei_

Details for d1ppee_

PDB Entry: 1ppe, 2 Å

PDB Description: the refined 2.0 angstroms x-ray crystal structure of the complex formed between bovine beta-trypsin and cmti-i, a trypsin inhibitor from squash seeds (cucurbita maxima): topological similarity of the squash seed inhibitors with the carboxypeptidase a inhibitor from potatoes

SCOP Domain Sequences for d1ppee_:

Sequence; same for both SEQRES and ATOM records:

>d1ppee_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1ppee_:

• d1ppee_ appears in SCOP 1.57
  
• d1ppee_ appears in the current release, SCOPe 2.08