| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) ![]() |
| Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins automatically mapped to Pfam PF01880 |
| Protein automated matches [190694] (3 species) not a true protein |
| Species Archaeoglobus fulgidus [TaxId:2234] [237934] (4 PDB entries) |
| Domain d4c4um_: 4c4u M: [258646] automated match to d4bfkb_ complexed with fe2; mutant |
PDB Entry: 4c4u (more details), 2.58 Å
SCOPe Domain Sequences for d4c4um_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c4um_ b.1.13.1 (M:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
elfqtadwkkqkhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegsk
fpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgeat
lsl
Timeline for d4c4um_: