Lineage for d4c4up_ (4c4u P:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038341Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 2038342Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
    automatically mapped to Pfam PF01880
  6. 2038365Protein automated matches [190694] (3 species)
    not a true protein
  7. 2038366Species Archaeoglobus fulgidus [TaxId:2234] [237934] (4 PDB entries)
  8. 2038390Domain d4c4up_: 4c4u P: [258645]
    automated match to d4bfkb_
    complexed with fe2; mutant

Details for d4c4up_

PDB Entry: 4c4u (more details), 2.58 Å

PDB Description: Superoxide reductase (Neelaredoxin) from Archaeoglobus fulgidus E12Q mutant in the reduced form
PDB Compounds: (P:) superoxide reductase

SCOPe Domain Sequences for d4c4up_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c4up_ b.1.13.1 (P:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
elfqtadwkkqkhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegsk
fpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgeat
lsl

SCOPe Domain Coordinates for d4c4up_:

Click to download the PDB-style file with coordinates for d4c4up_.
(The format of our PDB-style files is described here.)

Timeline for d4c4up_: