Lineage for d1tpae_ (1tpa E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15329Protein Trypsin(ogen) [50515] (6 species)
  7. 15330Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries)
  8. 15422Domain d1tpae_: 1tpa E: [25864]
    Other proteins in same PDB: d1tpai_

Details for d1tpae_

PDB Entry: 1tpa (more details), 1.9 Å

PDB Description: the geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors

SCOP Domain Sequences for d1tpae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpae_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1tpae_:

Click to download the PDB-style file with coordinates for d1tpae_.
(The format of our PDB-style files is described here.)

Timeline for d1tpae_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tpai_