Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (43 species) not a true protein |
Species Dromaius novaehollandiae [TaxId:8790] [258618] (1 PDB entry) |
Domain d3wtgc_: 3wtg C: [258623] automated match to d1bz1a_ complexed with hem, oxy |
PDB Entry: 3wtg (more details), 2.3 Å
SCOPe Domain Sequences for d3wtgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wtgc_ a.1.1.2 (C:) automated matches {Dromaius novaehollandiae [TaxId: 8790]} vlsaadktntksvfakigphaeeygaetlerlfttypqtktyfphfdlhhgsaqvkahgk kvaaalveaanhiddistalsklsdlhaqklrvdpvnfkllgqcflvvvaihhpslltpe vhasldkflcavanvlta
Timeline for d3wtgc_: