Lineage for d3wtgc_ (3wtg C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688639Species Dromaius novaehollandiae [TaxId:8790] [258618] (1 PDB entry)
  8. 2688642Domain d3wtgc_: 3wtg C: [258623]
    automated match to d1bz1a_
    complexed with hem, oxy

Details for d3wtgc_

PDB Entry: 3wtg (more details), 2.3 Å

PDB Description: Crystal structure of Emu (dromaius novaehollandiae) hemoglobin at 2.3 angstrom resolution
PDB Compounds: (C:) Hemoglobin subunit alpha-A

SCOPe Domain Sequences for d3wtgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wtgc_ a.1.1.2 (C:) automated matches {Dromaius novaehollandiae [TaxId: 8790]}
vlsaadktntksvfakigphaeeygaetlerlfttypqtktyfphfdlhhgsaqvkahgk
kvaaalveaanhiddistalsklsdlhaqklrvdpvnfkllgqcflvvvaihhpslltpe
vhasldkflcavanvlta

SCOPe Domain Coordinates for d3wtgc_:

Click to download the PDB-style file with coordinates for d3wtgc_.
(The format of our PDB-style files is described here.)

Timeline for d3wtgc_: