Lineage for d1tyn__ (1tyn -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (128 PDB entries) 
Domain d1tyn__: 1tyn - [25862]
Details for d1tyn__
PDB Entry: 1tyn (more details), 2 Å
PDB Description: atomic structure of the trypsin-cyclotheonamide a complex: lessons for the design of serine protease inhibitors
SCOP Domain Sequences for d1tyn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tyn__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d1tyn__:
Click to download the PDB-style file with coordinates for d1tyn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tyn__:
- d1tyn__ first appeared (with stable ids) in SCOP 1.55
- d1tyn__ appears in SCOP 1.59
- d1tyn__ appears in the current release, SCOPe 2.08, called d1tyna_
View in 3D