SCOPe 2.05: Domain d3we6b2: 3we6 B:113-217

Lineage for d3we6b2 (3we6 B:113-217)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d3we6b2: 3we6 B:113-217 [258614]
   Other proteins in same PDB: d3we6b1
   automated match to d2ojzl2
   complexed with ipa

Details for d3we6b2

PDB Entry: 3we6, 2.02 Å

PDB Description: Crystal structure of anti-Prostaglandin E2 Fab fragment

PDB Compounds: (B:) mAb Fab L fragment

SCOPe Domain Sequences for d3we6b2:

Sequence; same for both SEQRES and ATOM records:

>d3we6b2 b.1.1.2 (B:113-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d3we6b2:

• d3we6b2 first appeared in SCOPe 2.04
  
• d3we6b2 appears in SCOPe 2.06
  
• d3we6b2 appears in the current release, SCOPe 2.08