SCOPe 2.05: Domain d3we6b1: 3we6 B:1-112

Lineage for d3we6b1 (3we6 B:1-112)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries)

8. Domain d3we6b1: 3we6 B:1-112 [258613]
   Other proteins in same PDB: d3we6b2
   automated match to d2ok0l1
   complexed with ipa

Details for d3we6b1

PDB Entry: 3we6, 2.02 Å

PDB Description: Crystal structure of anti-Prostaglandin E2 Fab fragment

PDB Compounds: (B:) mAb Fab L fragment

SCOPe Domain Sequences for d3we6b1:

Sequence; same for both SEQRES and ATOM records:

>d3we6b1 b.1.1.1 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkinrveaedlgiyyclqgshvpltfgagttlelk

Timeline for d3we6b1:

• d3we6b1 first appeared in SCOPe 2.04
  
• d3we6b1 appears in SCOPe 2.06
  
• d3we6b1 appears in the current release, SCOPe 2.07