SCOPe 2.08: Domain d3wfhb2: 3wfh B:113-216

Lineage for d3wfhb2 (3wfh B:113-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3wfhb2: 3wfh B:113-216 [258612]
   Other proteins in same PDB: d3wfha_, d3wfhb1
   automated match to d2ojzl2
   complexed with p2e

Details for d3wfhb2

PDB Entry: 3wfh, 1.9 Å

PDB Description: Crystal structure of anti-Prostaglandin E2 Fab fragment PGE2 complex

PDB Compounds: (B:) mAb Fab L fragment

SCOPe Domain Sequences for d3wfhb2:

Sequence; same for both SEQRES and ATOM records:

>d3wfhb2 b.1.1.2 (B:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d3wfhb2:

• d3wfhb2 first appeared in SCOPe 2.04
  
• d3wfhb2 appears in SCOPe 2.07