Lineage for d3wkrb1 (3wkr B:21-396)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132627Species Methanocaldococcus jannaschii [TaxId:243232] [258609] (2 PDB entries)
  8. 2132631Domain d3wkrb1: 3wkr B:21-396 [258610]
    Other proteins in same PDB: d3wkra2, d3wkrb2, d3wkre2, d3wkrf2
    automated match to d2e7ja_
    protein/RNA complex

Details for d3wkrb1

PDB Entry: 3wkr (more details), 2.8 Å

PDB Description: crystal structure of the sepcyss-sepcyse complex from methanocaldococcus jannaschii
PDB Compounds: (B:) O-phospho-L-seryl-tRNA:Cys-tRNA synthase

SCOPe Domain Sequences for d3wkrb1:

Sequence, based on SEQRES records: (download)

>d3wkrb1 c.67.1.0 (B:21-396) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
dkyknltrsltrefinlnpiqrggilpkeakkavyeywdgysvcdychgrldevtcppik
dflediakflnmdcarpthgaregkfivmhaickegdyvvldknahytsyvaaeraklnv
aevgyeeeyptykinlegykevidnledkgknvglillthvdgeygnlndakkvgkiake
kgipfllncaytvgrmpvngkevkadfivasghksmaasapcgilafseefsdkitktse
kfpvkeiemlgctsrglpivtlmasfphvvervkkwdeelkktryvvdelekigfkqlgi
kpkehdlikfetpvldeiakkdkrrgfffydelkkrgiggiragvtkeikmsvygleweq
veyvvnaikeivesck

Sequence, based on observed residues (ATOM records): (download)

>d3wkrb1 c.67.1.0 (B:21-396) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
dkyknltrsltrefinlnpiqrggilpkeakkavyeywdgcppikdflediakflnmdca
rpthgaregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeyptykin
legykevidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncaytvgr
mpvngkevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgctsr
glpivtlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfetpvl
deiakkdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeivesc
k

SCOPe Domain Coordinates for d3wkrb1:

Click to download the PDB-style file with coordinates for d3wkrb1.
(The format of our PDB-style files is described here.)

Timeline for d3wkrb1: